Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NHA2/SLC9B2/NHEDC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | NHA2/SLC9B2/NHEDC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15957920
|
Novus Biologicals
NBP15957920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159579
|
Novus Biologicals
NBP159579 |
100 μL |
Each for $487.50
|
|
|||||
Description
NHA2/SLC9B2/NHEDC2 Polyclonal specifically detects NHA2/SLC9B2/NHEDC2 in Human samples. It is validated for Western Blot.Specifications
| NHA2/SLC9B2/NHEDC2 | |
| Polyclonal | |
| Rabbit | |
| Q86UD5 | |
| 133308 | |
| Synthetic peptides corresponding to NHEDC2(Na+/H+ exchanger domain containing 2) The peptide sequence was selected from the C terminal of NHEDC2. Peptide sequence IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2 | |
| SLC9B2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title