Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NHE1/SLC9A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238584
Description
NHE1/SLC9A1 Polyclonal specifically detects NHE1/SLC9A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NHE1/SLC9A1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
P19634 | |
SLC9A1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPA | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
APNH1, APNHFLJ42224, Na(+)/H(+) antiporter, amiloride-sensitive, Na(+)/H(+) exchanger 1, Na+/H+, amiloride sensitive), Na-Li countertransporter, NHE-1, NHE1Na+/H+ antiporter, amiloride-sensitive, sodium/hydrogen exchanger 1, solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, solute carrier family 9 (sodium/hydrogen exchanger), member 1, solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Solute carrier family 9 member 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
6548 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction