Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NHE8 Antibody, Novus Biologicals™

NHE8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159888 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159888 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159888 Supplier Novus Biologicals Supplier No. NBP159888
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

NHE8 Polyclonal specifically detects NHE8 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen NHE8
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q2M1U9
Gene Alias DKFZp686C03237, KIAA0939DKFZp686C03237, MGC138418, Na(+)/H(+) exchanger 8, NHE-8, NHE8FLJ42500, sodium/hydrogen exchanger 8, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 8, solute carrier family 9 (sodium/hydrogen exchanger), member 8, Solute carrier family 9 member 8
Gene Symbols SLC9A8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Golgi Apparatus Markers, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 23315
Test Specificity Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.