Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180092
Description
Nicotinic Acetylcholine R alpha 7/CHRNA7 Polyclonal specifically detects Nicotinic Acetylcholine R alpha 7/CHRNA7 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Nicotinic Acetylcholine R alpha 7/CHRNA7 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| a7 nicotinic acetylcholine receptor, alpha 7 neuronal nicotinic acetylcholine receptor, alpha-7 nicotinic cholinergic receptor subunit, cholinergic receptor, nicotinic, alpha 7, cholinergic receptor, nicotinic, alpha polypeptide 7, CHRNA7-2, NACHRA7, neuronal acetylcholine receptor protein, alpha-7 chain, neuronal acetylcholine receptor subunit alpha-7 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Pig: 100%; Canine: 92%; Mouse: 92%; Rat: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence | |
| NP_000737 | |
| CHRNA7 | |
| Synthetic peptide directed towards the middle region of human CHRNA7. Peptide sequence VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF. | |
| 100 μL | |
| Signal Transduction | |
| 1139 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction