Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179949
Description
Nicotinic Acetylcholine R alpha 9/CHRNA9 Polyclonal specifically detects Nicotinic Acetylcholine R alpha 9/CHRNA9 in Human samples. It is validated for Western Blot.Specifications
Nicotinic Acetylcholine R alpha 9/CHRNA9 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
cholinergic receptor, nicotinic, alpha 9, cholinergic receptor, nicotinic, alpha polypeptide 9, HSA243342, MGC142109, MGC142135, NACHR alpha 9, NACHR alpha-9, NACHRA9acetylcholine receptor, neuronal nicotinic, alpha-9 subunit, neuronal acetylcholine receptor protein, alpha-9 subunit, neuronal acetylcholine receptor subunit alpha-9, nicotinic acetylcholine receptor subunit alpha 9, Nicotinic acetylcholine receptor subunit alpha-9 | |
Rabbit | |
55 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Zebrafish: 80%. | |
Human, Mouse, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_060051 | |
CHRNA9 | |
Synthetic peptide directed towards the N terminal of human CHRNA9The immunogen for this antibody is CHRNA9. Peptide sequence MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE. | |
Affinity purified | |
RUO | |
55584 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction