Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIFK Antibody (CL2240), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NIFK |
---|---|
Clone | CL2240 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
Classification | Monoclonal |
Conjugate | Unconjugated |
Description
NIFK Monoclonal specifically detects NIFK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
NIFK | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
Mouse | |
Core ESC Like Genes, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67 | |
MKI67IP | |
IgG2a | |
Protein A purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
CL2240 | |
Monoclonal | |
Purified | |
RUO | |
Human | |
Q9BYG3 | |
84365 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI | |
Primary | |
Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title