NIPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190111

Catalog No. NBP190111

Description

NIPP1 Polyclonal specifically detects NIPP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NIPP1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: activator of RNA decay, ard-1, ARD1nuclear inhibitor of protein phosphatase 1, NIPP1nuclear inhibitor of protein phosphatase-1, NIPP-1nuclear subunit of PP-1, PRO2047, Protein phosphatase 1 regulatory inhibitor subunit 8, protein phosphatase 1 regulatory subunit 8, protein phosphatase 1, regulatory (inhibitor) subunit 8, RNase E
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP1R8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNK
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5511
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only