Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIPP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP190112
Description
NIPP1 Polyclonal specifically detects NIPP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
NIPP1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
activator of RNA decay, ard-1, ARD1nuclear inhibitor of protein phosphatase 1, NIPP1nuclear inhibitor of protein phosphatase-1, NIPP-1nuclear subunit of PP-1, PRO2047, Protein phosphatase 1 regulatory inhibitor subunit 8, protein phosphatase 1 regulatory subunit 8, protein phosphatase 1, regulatory (inhibitor) subunit 8, RNase E | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PPP1R8 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:THSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI | |
0.1 mL | |
Signal Transduction | |
5511 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction