NIPSNAP3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24667425UL

Catalog No. NB396361

Description

NIPSNAP3A Polyclonal antibody specifically detects NIPSNAP3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NIPSNAP3A
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9BS92
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: DKFZp564D177, FLJ13953, HSPC299, MGC14553, nipsnap homolog 3A (C. elegans), NipSnap3A, NipSnap4, protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C, TassC
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 25934
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG