Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NKIRAS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NKIRAS2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NKIRAS2 Polyclonal specifically detects NKIRAS2 in Human samples. It is validated for Western Blot.Specifications
NKIRAS2 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
DKFZP434N1526, I-kappa-B-interacting Ras-like protein 2, Kappa B-Ras protein 2, KappaB-Ras2, KBRAS2DKFZp434N1526, MGC74742, NF-kappa-B inhibitor-interacting Ras-like protein 2, NFKB inhibitor interacting Ras-like 2, NFKB inhibitor interacting Ras-like protein 2 | |
NKIRAS2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NYR9 | |
28511 | |
Synthetic peptides corresponding to NKIRAS2(NFKB inhibitor interacting Ras-like 2) The peptide sequence was selected from the middle region of NKIRAS2. Peptide sequence KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title