NKX2.8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23415025UL

Catalog No. NB436617

Description

NKX2.8 Polyclonal specifically detects NKX2.8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NKX2.8
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: O15522
• Gene Symbols: NKX2-8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Homeobox protein NK-2 homolog H, homeobox protein Nkx-2.8, NK2 homeobox 8, NK-2 homolog H (Drosophila), NK2 transcription factor related, locus 8, NK2 transcription factor related, locus 8 (Drosophila), NKX-2.8, NKX2.8NK-2 homolog 8, Nkx2-9, NKX2G, NKX2HNK-2 homolog H
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26257
• Target Species: Human
• Isotype: IgG

For Research Use Only