NLRP10/Pynod/NALP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18555625UL

Catalog No. NB406509

Description

NLRP10/Pynod/NALP10 Polyclonal specifically detects NLRP10/Pynod/NALP10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NLRP10/Pynod/NALP10
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CLR11.1, NACHT, leucine rich repeat and PYD containing 10, NALP10Pynod, NLR family, pyrin domain containing 10, NOD8Nucleotide-binding oligomerization domain protein 8, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 10, PAN5, PYNODNACHT, LRR and PYD domains-containing protein 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 338322
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NLRP10
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only