Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP90 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ZFP90 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZFP90 Polyclonal specifically detects ZFP90 in Mouse samples. It is validated for Western Blot.Specifications
| ZFP90 | |
| Polyclonal | |
| Rabbit | |
| NP_035894 | |
| 146198 | |
| Synthetic peptide towards Zfp90. Peptide sequence HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1954, NK10, zfp-90, zinc finger protein 476, zinc finger protein 756, zinc finger protein 90 homolog, zinc finger protein 90 homolog (mouse), ZNF756 | |
| ZFP90 | |
| IgG | |
| 72 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title