NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191382

Catalog No. NBP191382

Description

Zinc finger protein pseudogene Polyclonal specifically detects Zinc finger protein pseudogene in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Zinc finger protein pseudogene
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: LOC728743
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebra fish 83%.
• Target Species: Human, Mouse, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LOC728743
• Immunogen: Synthetic peptide directed towards the C terminal of humanZinc finger protein pseudogene. Peptide sequence ARMPAPHPRRPGVFGERRPYFCPRCGKSFAREGSLKTHQRSHGHGPEGQA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 728743
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.