ZSCAN5C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191389

Catalog No. NBP191389

Description

ZSCAN5C Polyclonal specifically detects ZSCAN5C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZSCAN5C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ZSCAN5C
• Immunogen: Synthetic peptide directed towards the C terminal of human LOC649137. Peptide sequence LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 649137
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ZNF495C, ZSCAN5C zinc finger and SCAN domain containing 5C
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Mouse: 92%; Xenopus: 91%; Crab-eating macaque: 91%; Transparent sea squirt: 91%; Green puffer: 91%; Sumatran orangutan: 91%; Golden hamster: 91%; African malaria mosquito: 91%; Canine: 91%; Chicken: 91%; Zebrafish: 91%; Southern house mosquito: 91%; Western clawed frog: 91%; Rat: 91%; Florida lancelet: 91%; Blood fluke: 91%; European domestic ferret: 91%; Atlantic salmon: 85%; Japanese pufferfish: 85%; Starlet sea anemone: 84%; Chimpanzee: 84%; Pig-tailed macaque: 84%; Rhesus macaque: 84%; Lowland gorilla: 84%; Pygmy chimpanzee: 84%; Western Gorilla: 78%; Red-chested mustached tamarin: 78%; Black-handed spider monkey: 78%; Bornean orangutan: 78%; Yellowfever mosquito: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG