Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZSCAN5C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZSCAN5C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZSCAN5C Polyclonal specifically detects ZSCAN5C in Human samples. It is validated for Western Blot.Specifications
ZSCAN5C | |
Polyclonal | |
Rabbit | |
ZNF495C, ZSCAN5C zinc finger and SCAN domain containing 5C | |
Synthetic peptide directed towards the C terminal of human LOC649137. Peptide sequence LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
649137 | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title