Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF724P Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF724P |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF724P Polyclonal specifically detects ZNF724P in Human samples. It is validated for Western Blot.Specifications
ZNF724P | |
Polyclonal | |
Rabbit | |
Human | |
440519 | |
Synthetic peptide directed towards the N terminal of human ZNF724P. Peptide sequence KGSYNGFNQCLTTTQSKIFQCDKYVKDFHKFSNSNRHKTEKNPFKCKECG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ZNF724P zinc finger protein 724, pseudogene | |
ZNF724P | |
IgG | |
77 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title