Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TYW5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TYW5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TYW5 Polyclonal specifically detects TYW5 in Human samples. It is validated for Western Blot.Specifications
TYW5 | |
Polyclonal | |
Rabbit | |
NP_001034782 | |
129450 | |
Synthetic peptide directed towards the middle region of human C2orf60. Peptide sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
tRNA-yW synthesizing protein 5 | |
TYW5 | |
IgG | |
36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title