Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VTI1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | VTI1A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
VTI1A Polyclonal specifically detects VTI1A in Human samples. It is validated for Western Blot.Specifications
VTI1A | |
Polyclonal | |
Rabbit | |
NP_660207 | |
143187 | |
Synthetic peptide directed towards the N terminal of human VTI1A. Peptide sequence SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MVti1, vesicle transport through interaction with t-SNAREs homolog 1A, vesicle transport through interaction with t-SNAREs homolog 1A (yeast) | |
VTI1A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title