Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM213B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM213B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM213B Polyclonal specifically detects FAM213B in Mouse samples. It is validated for Western Blot.Specifications
FAM213B | |
Polyclonal | |
Rabbit | |
NP_079858 | |
127281 | |
IgG | |
22 kDa |
Western Blot | |
Unconjugated | |
RUO | |
2810405K02Rik, C1orf93, chromosome 1 open reading frame 93, DKFZp547M123, family with sequence similarity 213, member B, prostamide/PG F synthase | |
The specific Immunogen is proprietary information. Peptide sequence SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title