Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BTNL9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | BTNL9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19143720
|
Novus Biologicals
NBP19143720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191437
|
Novus Biologicals
NBP191437 |
100 μL |
Each for $487.50
|
|
|||||
Description
BTNL9 Polyclonal specifically detects BTNL9 in Human samples. It is validated for Western Blot.Specifications
| BTNL9 | |
| Polyclonal | |
| Rabbit | |
| NP_689760 | |
| 153579 | |
| Synthetic peptide directed towards the N terminal of human BTNL9. Peptide sequence EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BTN3, butyrophilin 3, butyrophilin-like 9, butyrophilin-like protein 9, UNQ1900/PRO4346, VDLS1900 | |
| BTNL9 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title