Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC63 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC63 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC63 Polyclonal specifically detects CCDC63 in Human samples. It is validated for Western Blot.Specifications
CCDC63 | |
Polyclonal | |
Rabbit | |
NP_689804 | |
160762 | |
Synthetic peptide directed towards the middle region of human CCDC63. Peptide sequence: EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 63, FLJ35843 | |
CCDC63 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title