Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tau tubulin kinase 2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182388

 View more versions of this product

Catalog No. NBP182388


Only null left
Add to Cart

Description

Description

Tau tubulin kinase 2 Polyclonal specifically detects Tau tubulin kinase 2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

Tau tubulin kinase 2
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
EC 2.7.11, EC 2.7.11.1, KIAA0847tau-tubulin kinase 2, SCA11, spinocerebellar ataxia 11, tau tubulin kinase 2, TTBK
Rabbit
137 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
NP_001020027
TTBK2
Synthetic peptide towards tau tubulin kinase 2. Peptide sequence KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT.
Affinity purified
RUO
146057
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.