Tau tubulin kinase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182388

Catalog No. NBP182388

Description

Tau tubulin kinase 2 Polyclonal specifically detects Tau tubulin kinase 2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Tau tubulin kinase 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.1, KIAA0847tau-tubulin kinase 2, SCA11, spinocerebellar ataxia 11, tau tubulin kinase 2, TTBK
• Host Species: Rabbit
• Molecular Weight of Antigen: 137 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001020027
• Gene Symbols: TTBK2
• Immunogen: Synthetic peptide towards tau tubulin kinase 2. Peptide sequence KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 146057
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG