GABA-A R pi Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182390

Catalog No. NBP182390

Description

GABA-A R pi Polyclonal specifically detects GABA-A R pi in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: GABA-A R pi
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GABA(A) receptor subunit pi, gamma-aminobutyric acid (GABA) A receptor, pi, gamma-aminobutyric acid receptor subunit pi, MGC126386, MGC126387
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_666129
• Gene Symbols: GABRP
• Immunogen: Synthetic peptide towards GABA A receptor pi. Peptide sequence GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2568
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.