Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHKBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SHKBP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SHKBP1 Polyclonal specifically detects SHKBP1 in Mouse samples. It is validated for Western Blot.Specifications
SHKBP1 | |
Polyclonal | |
Rabbit | |
NP_619617 | |
92799 | |
Synthetic peptide towards Shkbp1. Peptide sequence RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PP203, Sb1, SH3KBP1 binding protein 1, SH3KBP1-binding protein 1 | |
SHKBP1 | |
IgG | |
76 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title