Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLMN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | CLMN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CLMN Polyclonal specifically detects CLMN in Human samples. It is validated for Western Blot.Specifications
| CLMN | |
| Polyclonal | |
| Rabbit | |
| NP_079010 | |
| 79789 | |
| Synthetic peptide directed towards the N terminal of human CLMN. Peptide sequence SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calmin, calmin (calponin-like, transmembrane), calponin like transmembrane domain protein, calponin-like transmembrane domain protein, FLJ12383, FLJ43048, KIAA1188 | |
| CLMN | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title