Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HDJ2 Antibody, Novus Biologicals™

HDJ2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19145320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19145320 20 μL
NBP191453 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19145320 Supplier Novus Biologicals Supplier No. NBP19145320UL

Description

Rabbit Polyclonal Antibody

HDJ2 Polyclonal specifically detects HDJ2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen HDJ2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_032324
Gene Alias dj-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, hDJ-2, HDJ2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7
Gene Symbols DNAJA1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD.
Molecular Weight of Antigen 44 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3301
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.