Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GRP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GRP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GRP Polyclonal specifically detects GRP in Mouse samples. It is validated for Western Blot.Specifications
GRP | |
Polyclonal | |
Rabbit | |
NP_776113 | |
29094 | |
The specific Immunogen is proprietary information. Peptide sequence CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
galectin-related protein, GRP, MGC33751, MGC71953 | |
LGALSL | |
IgG | |
19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title