Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TSPAN33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TSPAN33 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19146520
![]() |
Novus Biologicals
NBP19146520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191465
![]() |
Novus Biologicals
NBP191465 |
100 μL |
Each for $487.50
|
|
|||||
Description
TSPAN33 Polyclonal specifically detects TSPAN33 in Human samples. It is validated for Western Blot.Specifications
TSPAN33 | |
Polyclonal | |
Rabbit | |
NP_848657 | |
340348 | |
Synthetic peptide directed towards the middle region of human TSPAN33. Peptide sequence LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hPen, proerythroblast new membrane, tetraspanin 33, tetraspanin-33, tspan-33 | |
TSPAN33 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title