Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEX45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C19orf45 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TEX45 Polyclonal specifically detects TEX45 in Human samples. It is validated for Western Blot.Specifications
C19orf45 | |
Polyclonal | |
Rabbit | |
NP_940936 | |
374877 | |
Synthetic peptide directed towards the middle region of human C19orf45. Peptide sequence QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 19 open reading frame 45, FLJ35784, FLJ56642, hypothetical protein LOC374877 | |
C19ORF45 | |
IgG | |
56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title