Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGC50722 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MGC50722 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MGC50722 Polyclonal specifically detects MGC50722 in Human samples. It is validated for Western Blot.Specifications
MGC50722 | |
Polyclonal | |
Rabbit | |
NP_976223 | |
399693 | |
Synthetic peptide directed towards the N terminal of human MGC50722. Peptide sequence DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hypothetical MGC50722, hypothetical protein LOC399693 | |
MGC50722 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title