Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC37A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | LRRC37A3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19147420
![]() |
Novus Biologicals
NBP19147420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191474
![]() |
Novus Biologicals
NBP191474 |
100 μL |
Each for $487.50
|
|
|||||
Description
LRRC37A3 Polyclonal specifically detects LRRC37A3 in Human samples. It is validated for Western Blot.Specifications
LRRC37A3 | |
Polyclonal | |
Rabbit | |
NP_955372 | |
374819 | |
Synthetic peptide directed towards the middle region of human LRRC37A3. Peptide sequence NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ34306, KIAA0563, leucine rich repeat containing 37, member A3, leucine-rich repeat-containing protein 37A3, LRRC37A, MGC41826, MGC57168 | |
LRRC37A3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title