Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LOC684800 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LOC684800 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LOC684800 Polyclonal specifically detects LOC684800 in Rat samples. It is validated for Western Blot.Specifications
LOC684800 | |
Polyclonal | |
Rabbit | |
XP_002727223 | |
684800 | |
Synthetic peptide directed towards the N terminal of human LOC684800. Peptide sequence MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
similar to stromal membrane-associated protein 1 | |
LOC684800 | |
IgG | |
50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title