Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

p38 gamma/SAPK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	p38 gamma/SAPK3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP191479 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP191479	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

p38 gamma/SAPK3 Polyclonal specifically detects p38 gamma/SAPK3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	p38 gamma/SAPK3
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3
Gene Symbols	MAPK12
Isotype	IgG
Molecular Weight of Antigen	40 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_038899
Gene ID (Entrez)	6300
Immunogen	Synthetic peptide directed towards the C terminal of human Mapk12. Peptide sequence ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

p38 gamma/SAPK3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents