Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCID2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCID2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCID2 Polyclonal specifically detects PCID2 in Rat samples. It is validated for Western Blot.Specifications
PCID2 | |
Polyclonal | |
Rabbit | |
NP_001162615 | |
55795 | |
Synthetic peptide directed towards the middle region of human RGD1307041. Peptide sequence MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CSN12-like protein, DKFZp686C20226, F10, FLJ11305, FLJ99362, MGC16774, PCI domain containing 2, PCI domain-containing protein 2 | |
PCID2 | |
IgG | |
42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title