Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Argonaute 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191494
Description
Argonaute 3 Polyclonal specifically detects Argonaute 3 in Mouse samples. It is validated for Western Blot.Specifications
Argonaute 3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AGO3argonaute 3, argonaute3, eIF2C 3, eIF-2C 3, Eukaryotic translation initiation factor 2C 3, eukaryotic translation initiation factor 2C, 3, FLJ12765, hAgo3, MGC86946, protein argonaute-3 | |
Rabbit | |
97 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_700451 | |
AGO3 | |
The specific Immunogen is proprietary information. Peptide sequence VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP. | |
Affinity purified | |
RUO | |
192669 | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction