Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TFIIB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TFIIB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TFIIB Polyclonal specifically detects TFIIB in Rat samples. It is validated for Western Blot.Specifications
| TFIIB | |
| Polyclonal | |
| Rabbit | |
| NP_112303 | |
| 2959 | |
| The specific Immunogen is proprietary information. Peptide sequence GAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| general transcription factor IIB, General transcription factor TFIIB, S300-II, TFIIBTF2BRNA polymerase II transcription factor IIB, transcription initiation factor IIB | |
| GTF2B | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title