Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FOLR4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | FOLR4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191496
![]() |
Novus Biologicals
NBP191496 |
100 μL |
Each for $480.74
|
|
|||||
NBP19149620
![]() |
Novus Biologicals
NBP19149620UL |
20 μL | N/A | N/A | N/A | ||||
Description
FOLR4 Polyclonal specifically detects FOLR4 in Human samples. It is validated for Western Blot.Specifications
| FOLR4 | |
| Polyclonal | |
| Rabbit | |
| folate receptor 4 (delta) homolog (mouse), Folbp3, probable folate receptor delta | |
| FOLR4 | |
| IgG | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 390243 | |
| Synthetic peptide directed towards the middle region of human FOLR4. Peptide sequence TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title