Synaptotagmin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191499

Catalog No. NBP191499

Description

Synaptotagmin 1 Polyclonal specifically detects Synaptotagmin 1 in Mouse, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Synaptotagmin 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp781D2042, p65, SVP65, synaptotagmin Isynaptotagmin 1, synaptotagmin-1, SYT, SytI
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_033332
• Gene Symbols: SYT1
• Immunogen: Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6857
• Target Species: Mouse, Bovine, Rat, Canine, Equine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG