Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-38/IL-1F10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IL-38/IL-1F10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IL-38/IL-1F10 Polyclonal specifically detects IL-38/IL-1F10 in Human samples. It is validated for Western Blot.Specifications
IL-38/IL-1F10 | |
Polyclonal | |
Rabbit | |
NP_115945 | |
84639 | |
Synthetic peptide directed towards the middle region of human IL1F10. Peptide sequence SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
interleukin 1 family, member 10 (theta), UNQ6119/PRO20041 | |
IL1F10 | |
IgG | |
17 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title