Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR87 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19151020UL
Description
WDR87 Polyclonal specifically detects WDR87 in Human samples. It is validated for Western Blot.Specifications
WDR87 | |
Polyclonal | |
Western Blot 1:1000 | |
BAC87627 | |
WDR87 | |
The specific Immunogen is proprietary information. Peptide sequence PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS. | |
Affinity Purified | |
RUO | |
83889 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
testis development protein NYD-SP11, WD repeat domain 87 | |
Rabbit | |
150 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction