ARHGAP19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191513

Catalog No. NBP191513

Description

ARHGAP19 Polyclonal specifically detects ARHGAP19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARHGAP19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp313K217, MGC138804, MGC138805, MGC14258, putative RhoGAP protein, Rho GTPase activating protein 19, rho GTPase-activating protein 19, rho-type GTPase-activating protein 19
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116289
• Gene Symbols: ARHGAP19
• Immunogen: Synthetic peptide directed towards the C terminal of human ARHGAP19. Peptide sequence: QFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKN
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84986
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.