Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR87 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | WDR87 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19151020
![]() |
Novus Biologicals
NBP19151020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191510
![]() |
Novus Biologicals
NBP191510 |
100 μL |
Each for $487.50
|
|
|||||
Description
WDR87 Polyclonal specifically detects WDR87 in Human samples. It is validated for Western Blot.Specifications
WDR87 | |
Polyclonal | |
Rabbit | |
Human | |
testis development protein NYD-SP11, WD repeat domain 87 | |
WDR87 | |
IgG | |
150 kDa |
Western Blot | |
Unconjugated | |
RUO | |
BAC87627 | |
83889 | |
The specific Immunogen is proprietary information. Peptide sequence PQRELEWDRSQEFFFWHSRVRAISNTEYPKNKEEDEHFLEMRLSKDVTYS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title