Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARHGAP19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ARHGAP19 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARHGAP19 Polyclonal specifically detects ARHGAP19 in Human samples. It is validated for Western Blot.Specifications
ARHGAP19 | |
Polyclonal | |
Rabbit | |
NP_116289 | |
84986 | |
Synthetic peptide directed towards the C terminal of human ARHGAP19. Peptide sequence: PTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp313K217, MGC138804, MGC138805, MGC14258, putative RhoGAP protein, Rho GTPase activating protein 19, rho GTPase-activating protein 19, rho-type GTPase-activating protein 19 | |
ARHGAP19 | |
IgG | |
56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title