Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody
$464.00
Specifications
Antigen | ZNF252 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF252 Polyclonal specifically detects ZNF252 in Human samples. It is validated for Western Blot.Specifications
ZNF252 | |
Polyclonal | |
Rabbit | |
ZNF252P zinc finger protein 252, pseudogene | |
ZNF252 | |
IgG | |
Affinity Purified | |
75 kDa |
Western Blot | |
Unconjugated | |
RUO | |
286101 | |
Synthetic peptide directed towards the middle region of human ZNF252. Peptide sequence QRIHTGEKPYECNECAKSFSLNRTLTVHQRIHTGEKPYRCNECGKSFSQCS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title