ONECUT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191528

Catalog No. NBP191528

Description

ONECUT3 Polyclonal specifically detects ONECUT3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ONECUT3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ONECUT3
• Immunogen: Synthetic peptide directed towards the C terminal of human LOC390874. Peptide sequence ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 390874
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG