Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ONECUT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ONECUT3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ONECUT3 Polyclonal specifically detects ONECUT3 in Human samples. It is validated for Western Blot.Specifications
ONECUT3 | |
Polyclonal | |
Rabbit | |
XP_372702 | |
390874 | |
Synthetic peptide directed towards the C terminal of human LOC390874. Peptide sequence VTISQQLGLELNTVSNFFMNARRRCMNRWAEEPSTAPGGPAGATATFSKA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3 | |
ONECUT3 | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title