Use1/UBE2Z Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191539

Catalog No. NBP191539

Description

Use1/UBE2Z Polyclonal specifically detects Use1/UBE2Z in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Use1/UBE2Z
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MDS032, P31, protein p31, putative MAPK activating protein PM26, Putative MAPK-activating protein PM26, Q-SNARE, SLT1, SNARE-like tail-anchored protein 1 homolog, unconventional SNARE in the ER 1 homolog (S. cerevisiae), USE1L, USE1-like protein, vesicle transport protein USE1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55850
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_080193
• Gene Symbols: USE1
• Immunogen: Synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Peptide sequence MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Rat: 92%.
• Target Species: Mouse, Rat
• Form: Purified