Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Use1/UBE2Z Antibody, Novus Biologicals™

Use1/UBE2Z Antibody, Novus Biologicals™
SDP

Catalog No. NBP191539 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191539 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191539 Supplier Novus Biologicals Supplier No. NBP191539
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Use1/UBE2Z Polyclonal specifically detects Use1/UBE2Z in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Use1/UBE2Z
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_080193
Gene Alias MDS032, P31, protein p31, putative MAPK activating protein PM26, Putative MAPK-activating protein PM26, Q-SNARE, SLT1, SNARE-like tail-anchored protein 1 homolog, unconventional SNARE in the ER 1 homolog (S. cerevisiae), USE1L, USE1-like protein, vesicle transport protein USE1
Gene Symbols USE1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Peptide sequence MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55850
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Rat: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.