Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Islet-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Islet-2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19153520
|
Novus Biologicals
NBP19153520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP191535
|
Novus Biologicals
NBP191535 |
100 μL |
Each for $487.50
|
|
|||||
Description
Islet-2 Polyclonal specifically detects Islet-2 in Mouse samples. It is validated for Western Blot.Specifications
| Islet-2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ10160, insulin gene enhancer protein ISL-2, ISL LIM homeobox 2, ISL2 transcription factor, LIM/homeodomain, (islet-2), islet-2 | |
| ISL2 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_081673 | |
| 64843 | |
| Synthetic peptide directed towards the C terminal of mouse ISL2. Peptide sequence VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH. | |
| Primary | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title