Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF534 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF534 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF534 Polyclonal specifically detects ZNF534 in Human samples. It is validated for Western Blot.Specifications
ZNF534 | |
Polyclonal | |
Rabbit | |
Human | |
147658 | |
Synthetic peptide directed towards the middle region of human ZNF534. Peptide sequence VFRVEAWRASGGAEEPTGPNFVGNDSPLPSPLALLPFPSVSASLGDAKRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ25344, KRAB domain only 3, KRAB domain only protein 3, KRBO3, zinc finger protein 534 | |
ZNF534 | |
IgG | |
21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title